PMEL17/SILV Antibody

Images

 
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - Human kidney
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMEL17/SILV Antibody Summary

Immunogen
Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY.
Marker
Melanosome Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMEL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SILV and was validated on Western Blot and immunohistochemistry.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-69571 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PMEL17/SILV Antibody

  • D12S53EP1
  • gp100
  • ME20
  • ME20-M
  • melanocyte protein mel 17
  • Melanocyte protein Pmel 17
  • Melanocytes lineage-specific antigen GP100
  • Melanoma-associated ME20 antigen
  • melanosomal matrix protein17
  • PMEL17P100
  • premelanosome proteinME20M
  • SI
  • SIL
  • silver (mouse homolog) like
  • silver homolog (mouse)
  • Silver locus protein homolog
  • silver, mouse, homolog of
  • SILVPmel17

Background

SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PMEL17/SILV Antibody (NBP1-69571)(4)

Reviews for PMEL17/SILV Antibody (NBP1-69571) (0)

There are no reviews for PMEL17/SILV Antibody (NBP1-69571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMEL17/SILV Antibody (NBP1-69571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMEL17/SILV Products

Bioinformatics Tool for PMEL17/SILV Antibody (NBP1-69571)

Discover related pathways, diseases and genes to PMEL17/SILV Antibody (NBP1-69571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMEL17/SILV Antibody (NBP1-69571)

Discover more about diseases related to PMEL17/SILV Antibody (NBP1-69571).
 

Pathways for PMEL17/SILV Antibody (NBP1-69571)

View related products by pathway.

PTMs for PMEL17/SILV Antibody (NBP1-69571)

Learn more about PTMs related to PMEL17/SILV Antibody (NBP1-69571).

Blogs on PMEL17/SILV

There are no specific blogs for PMEL17/SILV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMEL17/SILV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMEL
Entrez
Uniprot