PMEL17/SILV Antibody

Images

 
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, ...read more
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - Human kidney

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gt, GpSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMEL17/SILV Antibody Summary

Immunogen
Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY. The peptide sequence for this immunogen was taken from within the described region.
Marker
Melanosome Marker
Predicted Species
Rat (93%), Goat (93%), Equine (93%), Bovine (93%), Guinea Pig (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMEL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SILV and was validated on Western Blot and immunohistochemistry.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-69571 in the following applications:

  • IHC
    2 publications
  • 3 publications
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26511633).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PMEL17/SILV Antibody

  • D12S53EP1
  • Gp100
  • ME20
  • ME20M
  • ME20-M
  • melanocyte protein mel 17
  • Melanocyte protein Pmel 17
  • Melanocytes lineage-specific antigen GP100
  • Melanoma-associated ME20 antigen
  • melanosomal matrix protein17
  • PMEL
  • PMEL17
  • PMEL17P100
  • premelanosome proteinME20M
  • SI
  • SIL
  • SILV
  • silver (mouse homolog) like
  • silver homolog (mouse)
  • Silver locus protein homolog
  • silver, mouse, homolog of
  • SILVPmel17

Background

SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
AF5065
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-69571
Species: Hu, Mu, Rt, Bv, Eq, Gt, Gp
Applications: WB, IHC, IHC-P

Publications for PMEL17/SILV Antibody (NBP1-69571)(7)

We have publications tested in 2 confirmed species: Mouse, Human;Mouse.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(2)
IHC-P
(3)
WB
(1)
All Applications
Filter By Species
Mouse
(4)
Human;Mouse
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-69571 Applications Species
Forsthuber A, Lipp K, Andersen L et al. CXCL5 as Regulator of Neutrophil Function in Cutaneous Melanoma J. Invest. Dermatol. Jan 1 2019 [PMID: 30009831] (IHC, Mouse) IHC Mouse
Riesenberg S, Groetchen A, Siddaway R et al. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nat Commun. 2015 Nov 04 [PMID: 26530832] (IHC-P, Mouse) IHC-P Mouse
Holzel M, Landsberg J, Glodde N et al. A preclinical model of malignant peripheral nerve sheath tumor-like melanoma is characterized by infiltrating mast cells. Cancer Res. 2015 Oct 28 [PMID: 26511633] (IHC-P, Human;Mouse) IHC-P Human;Mouse
Bald T, Quast T, Landsberg J et al. Ultraviolet-radiation-induced inflammation promotes angiotropism and metastasis in melanoma. Nature 2014 Mar 6 [PMID: 24572365] (IHC-P, Mouse) IHC-P Mouse
Theos AC, Truschel ST, Tenza D et al. A lumenal domain-dependent pathway for sorting to intralumenal vesicles of multivesicular endosomes involved in organelle morphogenesis. Dev Cell. 2006 [PMID: 16516837]
Glodde N, Kraut A, van den Boorn-Konijnenberg D Experimental and stochastic models of melanoma T-cell therapy define impact of subclone fitness on selection of antigen loss variants bioRxiv (IHC, Mouse) IHC Mouse
Braun AD, Mengoni M, Bonifatius S et al. Activated Hgf-Met signaling cooperates with oncogenic Braf to drive primary cutaneous melanomas and angiotropic lung metastases in mice J. Invest. Dermatol. Jan 20 2020 [PMID: 31972251] (WB) WB

Reviews for PMEL17/SILV Antibody (NBP1-69571) (0)

There are no reviews for PMEL17/SILV Antibody (NBP1-69571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMEL17/SILV Antibody (NBP1-69571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PMEL17/SILV Products

Bioinformatics Tool for PMEL17/SILV Antibody (NBP1-69571)

Discover related pathways, diseases and genes to PMEL17/SILV Antibody (NBP1-69571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMEL17/SILV Antibody (NBP1-69571)

Discover more about diseases related to PMEL17/SILV Antibody (NBP1-69571).
 

Pathways for PMEL17/SILV Antibody (NBP1-69571)

View related products by pathway.

PTMs for PMEL17/SILV Antibody (NBP1-69571)

Learn more about PTMs related to PMEL17/SILV Antibody (NBP1-69571).

Blogs on PMEL17/SILV

There are no specific blogs for PMEL17/SILV, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMEL17/SILV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMEL
Entrez
Uniprot