PLZF Antibody (3A7)

Images

 
Western Blot: PLZF Antibody (3A7) [H00007704-M01] - Analysis of ZBTB16 expression in transfected 293T cell line by ZBTB16 monoclonal antibody (M01), clone 3A7.Lane 1: ZBTB16 transfected lysate (Predicted MW: 11.11 ...read more
Proximity Ligation Assay: PLZF Antibody (3A7) [H00007704-M01] - Analysis of protein-protein interactions between TRAF2 and ZBTB16. HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: PLZF Antibody (3A7) [H00007704-M01] - Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
3A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLZF Antibody (3A7) Summary

Immunogen
ZBTB16 (AAH29812, 381 a.a. - 480 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
Localization
Nuclear
Specificity
ZBTB16 - zinc finger and BTB domain containing 16
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZBTB16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLZF Antibody (3A7)

  • PLZF
  • PLZFzinc finger and BTB domain-containing protein 16
  • ZBTB16
  • zinc finger and BTB domain containing 16
  • zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia)
  • Zinc finger protein 145
  • Zinc finger protein PLZF
  • ZNF145
  • ZNF145Promyelocytic leukemia zinc finger protein

Background

This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00027033-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00007704-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for PLZF Antibody (H00007704-M01) (0)

There are no publications for PLZF Antibody (H00007704-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLZF Antibody (H00007704-M01) (0)

There are no reviews for PLZF Antibody (H00007704-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLZF Antibody (H00007704-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLZF Products

Bioinformatics Tool for PLZF Antibody (H00007704-M01)

Discover related pathways, diseases and genes to PLZF Antibody (H00007704-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLZF Antibody (H00007704-M01)

Discover more about diseases related to PLZF Antibody (H00007704-M01).
 

Pathways for PLZF Antibody (H00007704-M01)

View related products by pathway.

PTMs for PLZF Antibody (H00007704-M01)

Learn more about PTMs related to PLZF Antibody (H00007704-M01).
 

Research Areas for PLZF Antibody (H00007704-M01)

Find related products by research area.

Blogs on PLZF

There are no specific blogs for PLZF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLZF Antibody (3A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB16
Entrez
OMIM
Uniprot