Recombinant Human PLVAP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLVAP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 51-150 of Human PLVAP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NVHVSTESNLQATERRAEGLYSQLLGLTASQSNLTKELNFTTRAKDAIMQMWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSEKQCRDQFKDM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLVAP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLVAP Protein

  • FELS
  • FELSfenestrated-endothelial linked structure protein; PV-1 protein
  • Fenestrated endothelial-linked structure protein
  • gp68
  • plasmalemma vesicle associated protein
  • PLVAP
  • PV1
  • PV-1
  • PV1Plasmalemma vesicle protein 1
  • PV-1plasmalemma vesicle-associated protein

Background

PLVAP - plasmalemma vesicle associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF3014
Species: Hu
Applications: WB, IHC, Block
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLVAP Partial Recombinant Protein (H00083483-Q01) (0)

There are no publications for PLVAP Partial Recombinant Protein (H00083483-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLVAP Partial Recombinant Protein (H00083483-Q01) (0)

There are no reviews for PLVAP Partial Recombinant Protein (H00083483-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLVAP Partial Recombinant Protein (H00083483-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLVAP Products

Bioinformatics Tool for PLVAP Partial Recombinant Protein (H00083483-Q01)

Discover related pathways, diseases and genes to PLVAP Partial Recombinant Protein (H00083483-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLVAP Partial Recombinant Protein (H00083483-Q01)

Discover more about diseases related to PLVAP Partial Recombinant Protein (H00083483-Q01).
 

Pathways for PLVAP Partial Recombinant Protein (H00083483-Q01)

View related products by pathway.

PTMs for PLVAP Partial Recombinant Protein (H00083483-Q01)

Learn more about PTMs related to PLVAP Partial Recombinant Protein (H00083483-Q01).

Blogs on PLVAP

There are no specific blogs for PLVAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLVAP Antibody
NBP2-19868
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLVAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLVAP
Entrez