PLOD3 Antibody - BSA Free

Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLOD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLOD3 Antibody - BSA Free (NBP3-25058) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PLOD3 using the following amino acid sequence: PYISQAYVIRGDTLRMELPQRDVFSGSDTDPDMAFCKSFRDKGIFLHLSNQHE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLOD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Reactivity Notes

Mouse (89%), Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLOD3 Antibody - BSA Free

• 2-oxoglutarate 5-dioxygenase 3
• EC 1.14.11.4
• LH3Lysyl hydroxylase 3
• lysine hydroxylase 3
• procollagen-lysine
• procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3

Background

PLOD3 is encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLOD3