![Western Blot: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Western blot analysis of Mouse ovary, using GLT25D1 antibody (A16571) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-03665_rabbit-polyclonal-glt25d1-antibody-52202519302933.jpg "Western Blot: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Western blot analysis of Mouse ovary, using GLT25D1 antibody (A16571) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human GLT25D1 (NP_078932.2). APPGADAYFPEERWSPESPLQAPRVLIALLARNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLLIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COLGALT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 71 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GLT25D1 Antibody (NBP3-03665)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COLGALT1 |
![Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of SH-SY5Y cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03665_rabbit-polyclonal-glt25d1-antibody-5220251929451.jpg "Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of SH-SY5Y cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of HeLa cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03665_rabbit-polyclonal-glt25d1-antibody-5220251929450.jpg "Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of HeLa cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of PC-12 cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03665_rabbit-polyclonal-glt25d1-antibody-5220251930294.jpg "Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of PC-12 cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of NIH/3T3 cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03665_rabbit-polyclonal-glt25d1-antibody-52202519302934.jpg "Immunocytochemistry/ Immunofluorescence: GLT25D1 Antibody - Azide and BSA Free [NBP3-03665] - Immunofluorescence analysis of NIH/3T3 cells using GLT25D1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Western_Blot_21471.jpg)
![Immunohistochemistry Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-3_AF1197_Immunohistochemistry_7115.jpg)
![Simple Western Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Simple_Western_18971.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")