PLOD3 Antibody (5R6Q9)

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] - Western blot analysis of various lysates using PLOD3 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Western Blot: PLOD3 Antibody (5R6Q9) [NBP3-33264] - Western blot analysis of lysates from Mouse brain, using PLOD3 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 5R6Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PLOD3 Antibody (5R6Q9) Summary

• Description: Novus Biologicals Rabbit PLOD3 Antibody (5R6Q9) (NBP3-33264) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-306 of human PLOD3 (NP_001075.1).
  
  Sequence:
  SDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PLOD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PLOD3 Antibody (5R6Q9)

• 2-oxoglutarate 5-dioxygenase 3
• EC 1.14.11.4
• LH3Lysyl hydroxylase 3
• lysine hydroxylase 3
• procollagen-lysine
• procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3

Background

PLOD3 is encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLOD3