PLK4 Antibody

Images

 
Immunohistochemistry-Paraffin: PLK4 Antibody [NBP1-87095] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QWGNQETSNSGRGRVIQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERYSPTDNNANIFNFFKEKTSSSSGSFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLK4 Protein (NBP1-87095PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLK4 Antibody

  • EC 2.7.11.21
  • PLK-4
  • polo-like kinase 4 (Drosophila)
  • polo-like kinase 4SAKSTK18serine/threonine kinase 18
  • Sak
  • serine/threonine protein kinase SAK
  • Serine/threonine-protein kinase 18
  • serine/threonine-protein kinase PLK4
  • Serine/threonine-protein kinase Sak
  • Snk akin kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-20264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1310
Species: Hu
Applications: WB, IHC, IP
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87095
Species: Hu
Applications: IHC, IHC-P

Publications for PLK4 Antibody (NBP1-87095) (0)

There are no publications for PLK4 Antibody (NBP1-87095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK4 Antibody (NBP1-87095) (0)

There are no reviews for PLK4 Antibody (NBP1-87095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLK4 Antibody (NBP1-87095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLK4 Products

Bioinformatics Tool for PLK4 Antibody (NBP1-87095)

Discover related pathways, diseases and genes to PLK4 Antibody (NBP1-87095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK4 Antibody (NBP1-87095)

Discover more about diseases related to PLK4 Antibody (NBP1-87095).
 

Pathways for PLK4 Antibody (NBP1-87095)

View related products by pathway.

PTMs for PLK4 Antibody (NBP1-87095)

Learn more about PTMs related to PLK4 Antibody (NBP1-87095).
 

Research Areas for PLK4 Antibody (NBP1-87095)

Find related products by research area.

Blogs on PLK4

There are no specific blogs for PLK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLK4