PLEKHG2 Antibody - BSA Free

Western Blot: PLEKHG2 Antibody [NBP1-69100] - Human Fetal Heart Lysate, concentration 1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PLEKHG2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PLEKHG2 (pleckstrin homology domain containing, family G (with RhoGef domain) member 2) The peptide sequence was selected from the middle region of PLEKHG2. Peptide sequence DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLEKHG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 144 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PLEKHG2 Antibody - BSA Free

• ARHGEF42
• CLGFLJ38638
• common-site lymphoma/leukemia guanine nucleotide exchange factor
• DKFZp667J2325
• FLJ00018
• FLJ22458
• PH domain-containing family G member 2
• pleckstrin homology domain containing, family G (with RhoGef domain) member 2
• pleckstrin homology domain-containing family G member 2

Background

PLEKHG2 may be a transforming oncogene with exchange activity for CDC42. PLEKHG2 may be a guanine-nucleotide exchange factor (GEF) for RAC1 and CDC42.PLEKHG2 activated by the binding to subunits beta and gamma of the heterotrimeric guanine nucleotide-binding protein (G protein).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHG2