Pleckstrin Antibody (6E3.)

Images

 
Western Blot: Pleckstrin Antibody (6E3) [H00005341-M01] - PLEK monoclonal antibody (M01), clone 6E3 Analysis of PLEK expression in HeLa.
Immunohistochemistry-Paraffin: Pleckstrin Antibody (6E3) [H00005341-M01] - Analysis of monoclonal antibody to PLEK on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1 ug/ml.
Sandwich ELISA: Pleckstrin Antibody (6E3) [H00005341-M01] - Detection limit for recombinant GST tagged PLEK is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
6E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pleckstrin Antibody (6E3.) Summary

Immunogen
PLEK (AAH18549, 121 a.a. - 230 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENS
Specificity
PLEK - pleckstrin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLEK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pleckstrin Antibody (6E3.)

  • FLJ27168
  • p47
  • P47Platelet 47 kDa protein
  • pleckstrin

Background

Pleckstrin is the major protein kinase C substrate of platelets however its exact function is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Pleckstrin Antibody (H00005341-M01) (0)

There are no publications for Pleckstrin Antibody (H00005341-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pleckstrin Antibody (H00005341-M01) (0)

There are no reviews for Pleckstrin Antibody (H00005341-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pleckstrin Antibody (H00005341-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pleckstrin Products

Bioinformatics Tool for Pleckstrin Antibody (H00005341-M01)

Discover related pathways, diseases and genes to Pleckstrin Antibody (H00005341-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pleckstrin Antibody (H00005341-M01)

Discover more about diseases related to Pleckstrin Antibody (H00005341-M01).
 

Pathways for Pleckstrin Antibody (H00005341-M01)

View related products by pathway.

PTMs for Pleckstrin Antibody (H00005341-M01)

Learn more about PTMs related to Pleckstrin Antibody (H00005341-M01).
 

Research Areas for Pleckstrin Antibody (H00005341-M01)

Find related products by research area.

Blogs on Pleckstrin

There are no specific blogs for Pleckstrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pleckstrin Antibody (6E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEK
Entrez
OMIM
Uniprot