![Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Analysis in human small intestine and skeletal muscle tissues using NBP1-86180 antibody. Corresponding PLEK2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Pleckstrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86180-img0005.jpg "Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Analysis in human small intestine and skeletal muscle tissues using NBP1-86180 antibody. Corresponding PLEK2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Pleckstrin-2 Antibody - BSA Free (NBP1-86180) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWI |
| Predicted Species | Mouse (98%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLEK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Pleckstrin-2 Antibody (NBP1-86180)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLEK2 |
![Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Pleckstrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86180-img0008.jpg "Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Pleckstrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86180-img0006.jpg "Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/Pleckstrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86180-img0007.jpg "Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Pleckstrin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86180-img0009.jpg "Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.")
![Western Blot EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Western_Blot_17606.jpg)
![Immunocytochemistry EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Immunocytochemistry__Immunofluorescence_20119.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/Angiopoietin-2_DANG20_ELISA_30.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/DATA_Angiopoietin2_DANG20_ELISA_574.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot CD34 Antibody [Unconjugated]](https://images.novusbio.com/images/af4117_rat-cd34-affinity-purified-polyclonal-ab-western-blot-121220255555521.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images/af4117_rat-cd34-affinity-purified-polyclonal-ab-immunohistochemistry-12122025753482.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images/mab6210_human-phospho-pyk2-y402-mab-clone-592918-western-blot-1212202585785.jpg)
![Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Flow_Cytometry_11459.jpg)
![Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Flow_Cytometry_22010.jpg)
![Immunohistochemistry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Immunohistochemistry_12044.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")