Pleckstrin-2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Analysis in human small intestine and skeletal muscle tissues using NBP1-86180 antibody. Corresponding PLEK2 RNA-seq data ...read more
Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: Pleckstrin-2 Antibody [NBP1-86180] - Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Pleckstrin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWI
Predicted Species
Mouse (98%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pleckstrin-2 Protein (NBP1-86180PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pleckstrin-2 Antibody

  • pleckstrin 2 homolog
  • pleckstrin 2
  • pleckstrin-2

Background

PLEK2 may help orchestrate cytoskeletal arrangement. Contribute to lamellipodia formation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP3-05500
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6967
Species: Hu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF7109
Species: Mu
Applications: IHC, WB
AF3034
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-09499
Species: Hu
Applications: WB
DANG20
Species: Hu
Applications: ELISA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF446
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-86180
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Pleckstrin-2 Antibody (NBP1-86180) (0)

There are no publications for Pleckstrin-2 Antibody (NBP1-86180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pleckstrin-2 Antibody (NBP1-86180) (0)

There are no reviews for Pleckstrin-2 Antibody (NBP1-86180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Pleckstrin-2 Antibody (NBP1-86180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pleckstrin-2 Products

Bioinformatics Tool for Pleckstrin-2 Antibody (NBP1-86180)

Discover related pathways, diseases and genes to Pleckstrin-2 Antibody (NBP1-86180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pleckstrin-2 Antibody (NBP1-86180)

Discover more about diseases related to Pleckstrin-2 Antibody (NBP1-86180).
 

Pathways for Pleckstrin-2 Antibody (NBP1-86180)

View related products by pathway.

PTMs for Pleckstrin-2 Antibody (NBP1-86180)

Learn more about PTMs related to Pleckstrin-2 Antibody (NBP1-86180).
 

Research Areas for Pleckstrin-2 Antibody (NBP1-86180)

Find related products by research area.

Blogs on Pleckstrin-2

There are no specific blogs for Pleckstrin-2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pleckstrin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEK2