Plasminogen Antibody


Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon shows positivity in plasma.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Plasminogen Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Specificity of human Plasminogen antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Plasminogen Protein (NBP1-86015PEP)
Read Publication using
NBP1-86015 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25978044).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Plasminogen Antibody

  • DKFZp779M0222
  • EC 3.4.21
  • EC
  • plasmin
  • Plasminogen
  • Plg


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Plasminogen Antibody (NBP1-86015)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Plasminogen Antibody (NBP1-86015) (0)

There are no reviews for Plasminogen Antibody (NBP1-86015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Plasminogen Antibody (NBP1-86015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Plasminogen Products

Bioinformatics Tool for Plasminogen Antibody (NBP1-86015)

Discover related pathways, diseases and genes to Plasminogen Antibody (NBP1-86015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plasminogen Antibody (NBP1-86015)

Discover more about diseases related to Plasminogen Antibody (NBP1-86015).

Pathways for Plasminogen Antibody (NBP1-86015)

View related products by pathway.

PTMs for Plasminogen Antibody (NBP1-86015)

Learn more about PTMs related to Plasminogen Antibody (NBP1-86015).

Research Areas for Plasminogen Antibody (NBP1-86015)

Find related products by research area.

Blogs on Plasminogen

There are no specific blogs for Plasminogen, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Plasminogen Antibody and receive a gift card or discount.


Gene Symbol PLG