Plasminogen Antibody - BSA Free

Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon shows positivity in plasma.

Analysis in human plasma.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Plasminogen Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Plasminogen Antibody - BSA Free (NBP1-86015) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-Plasminogen Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ELISA reported in scientific literature (PMID: 25978044). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Plasminogen Protein (NBP1-86015PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25978044).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Plasminogen Antibody - BSA Free

• DKFZp779M0222
• EC 3.4.21
• EC 3.4.21.7
• plasmin
• Plasminogen
• Plg

Background

Plasminogen is a plasma protein synthesised mostly in the liver. Plasma concentration is usually in the range of 70 to 200mg/L. Plasminogen is activated by tissue plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Angiostatin, an internal fragment of plasminogen, is a potent inhibitor of angiogenesis, which selectively inhibits endothelial cell proliferation. Angiostatin potently inhibits tumor growth and can maintain metastatic and primary tumors in a dormant state. It is defined by a balance of proliferation and apoptosis of the tumor cells and is composed of plasminogen first four cringle structures. This molecule is generated by proteolytic cleavage of plasminogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Plasminogen Antibody (NBP1-86015)(1)

Publication using NBP1-86015

• Grundel A, Friedrich K, Pfeiffer M et al. Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen. PLoS One 2015-01-01 [PMID: 25978044] (ELISA, Human)

Bioinformatics

• Gene Symbol: PLG