PLAP Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLAA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50-1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PLAP Antibody - BSA Free
Background
Phospholipase A2 activator protein (PLAP), activates PLA2 (phospholipase A2 enzyme) and is an important mediator of eicosanoid generation. Also known as a pro-inflammatory agent, PLAP has been found in inflamed tissues and synovial fluid from patients with rheumatoid arthritis. As such, it is believed to play an important role in the regulation of inflammatory diseases. The formation of PLAP can be stimulated by IL-1 beta and TNF-alpha (1-2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, ELISA(Cap), S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for PLAP Antibody (NBP1-84997) (0)
There are no publications for PLAP Antibody (NBP1-84997).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLAP Antibody (NBP1-84997) (0)
There are no reviews for PLAP Antibody (NBP1-84997).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLAP Antibody (NBP1-84997) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLAP Products
Blogs on PLAP