PLAGL1 Antibody


Immunocytochemistry/ Immunofluorescence: PLAGL1 Antibody [NBP2-56498] - Staining of human cell line U-2 OS shows localization to nuclear bodies, the Golgi apparatus & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

PLAGL1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
Specificity of human PLAGL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLAGL1 Recombinant Protein Antigen (NBP2-56498PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PLAGL1 Antibody

  • DKFZp781P1017
  • LOT-1
  • LOT1ZACLost on transformation 1
  • MGC126275
  • MGC126276
  • PLAG-like 1
  • pleiomorphic adenoma gene-like 1
  • pleiomorphic adenoma gene-like protein 1
  • Pleiomorphic adenoma-like protein 1
  • Tumor supressor ZAC
  • ZAC tumor supressor
  • ZAC1
  • zinc finger protein PLAGL1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF

Publications for PLAGL1 Antibody (NBP2-56498) (0)

There are no publications for PLAGL1 Antibody (NBP2-56498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAGL1 Antibody (NBP2-56498) (0)

There are no reviews for PLAGL1 Antibody (NBP2-56498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLAGL1 Antibody (NBP2-56498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PLAGL1 Antibody (NBP2-56498)

Discover related pathways, diseases and genes to PLAGL1 Antibody (NBP2-56498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAGL1 Antibody (NBP2-56498)

Discover more about diseases related to PLAGL1 Antibody (NBP2-56498).

Pathways for PLAGL1 Antibody (NBP2-56498)

View related products by pathway.

PTMs for PLAGL1 Antibody (NBP2-56498)

Learn more about PTMs related to PLAGL1 Antibody (NBP2-56498).

Research Areas for PLAGL1 Antibody (NBP2-56498)

Find related products by research area.

Blogs on PLAGL1

There are no specific blogs for PLAGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLAGL1 Antibody and receive a gift card or discount.


Gene Symbol PLAGL1