PLAGL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PLAGL1 Antibody [NBP2-56498] - Staining of human cell line U-2 OS shows localization to nuclear bodies, the Golgi apparatus & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLAGL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAGL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLAGL1 Recombinant Protein Antigen (NBP2-56498PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PLAGL1 Antibody

  • DKFZp781P1017
  • LOT-1
  • LOT1ZACLost on transformation 1
  • MGC126275
  • MGC126276
  • PLAG-like 1
  • pleiomorphic adenoma gene-like 1
  • pleiomorphic adenoma gene-like protein 1
  • Pleiomorphic adenoma-like protein 1
  • Tumor supressor ZAC
  • ZAC tumor supressor
  • ZAC1
  • zinc finger protein PLAGL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00091833-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56498
Species: Hu
Applications: ICC/IF

Publications for PLAGL1 Antibody (NBP2-56498) (0)

There are no publications for PLAGL1 Antibody (NBP2-56498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAGL1 Antibody (NBP2-56498) (0)

There are no reviews for PLAGL1 Antibody (NBP2-56498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PLAGL1 Antibody (NBP2-56498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLAGL1 Products

Bioinformatics Tool for PLAGL1 Antibody (NBP2-56498)

Discover related pathways, diseases and genes to PLAGL1 Antibody (NBP2-56498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAGL1 Antibody (NBP2-56498)

Discover more about diseases related to PLAGL1 Antibody (NBP2-56498).
 

Pathways for PLAGL1 Antibody (NBP2-56498)

View related products by pathway.

PTMs for PLAGL1 Antibody (NBP2-56498)

Learn more about PTMs related to PLAGL1 Antibody (NBP2-56498).
 

Research Areas for PLAGL1 Antibody (NBP2-56498)

Find related products by research area.

Blogs on PLAGL1

There are no specific blogs for PLAGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAGL1