PLAGL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PLAGL1 Antibody [NBP2-56498] - Staining of human cell line U-2 OS shows localization to nuclear bodies, the Golgi apparatus & vesicles.

ChIP-Exo-Seq composite graph for Anti-PLAGL1 (NBP2-56498) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLAGL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLAGL1 Antibody - BSA Free (NBP2-56498) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLAGL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLAGL1 Recombinant Protein Antigen (NBP2-56498PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLAGL1 Antibody - BSA Free

• DKFZp781P1017
• LOT-1
• LOT1ZACLost on transformation 1
• MGC126275
• MGC126276
• PLAG-like 1
• pleiomorphic adenoma gene-like 1
• pleiomorphic adenoma gene-like protein 1
• Pleiomorphic adenoma-like protein 1
• Tumor supressor ZAC
• ZAC tumor supressor
• ZAC1
• zinc finger protein PLAGL1

Background

PLAGL1 encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLAGL1