PKN2 Antibody - BSA Free

Western Blot: PKN2 Antibody [NBP2-68736] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: PKN2 Antibody [NBP2-68736] - Immunohistochemical staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.

Immunocytochemistry/Immunofluorescence: PKN2 Antibody [NBP2-68736] - Staining of human cell line U-2 OS shows localization to nuclear bodies, cytosol & intermediate filaments.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKN2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKN2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Recommended conditions for ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, Recommended conditions for IHC: Retrieval method: HIER pH6
• Control Peptide:

  PKN2 Recombinant Protein Antigen (NBP2-68736PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for PKN2 Antibody - BSA Free

• cardiolipin-activated protein kinase Pak2
• EC 2.7.11
• EC 2.7.11.13
• PAK2
• Pak-2
• PKN2
• PRK2
• PRK2MGC150606
• PRKCL2
• PRKCL2PRO2042
• PRO2042
• Protein kinase C-like 2MGC71074
• protein kinase N2
• Protein-kinase C-related kinase 2
• serine/threonine-protein kinase N2

Background

Protein-kinase-C-related kinases (PRKs) (1) are part of the lipid-regulated protein kinases (PKC) which also include liver PAK & PKN (2-3). Human PRK1 and PRK2 share structurally similar catalytic domains, but less similar N-terminal regulatory regions suggesting different regulatory domain functions. PRK1 and PRK2, as well as a third member of this family, PRK3, show distinct patterns of expression in adult tissues. Additionally, the serine-threonine kinase PRK2 can be specifically cleaved by caspase-3 (and/or caspase-3-like subfamily members) during apoptosis (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKN2