PKN2 Antibody

Images

 
Western Blot: PKN2 Antibody [NBP2-13766] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PKN2 Antibody [NBP2-13766] - Staining of human kidney shows strong cytoplasmic positivity in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKD RI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PKN2 Protein (NBP2-13766PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKN2 Antibody

  • cardiolipin-activated protein kinase Pak2
  • EC 2.7.11
  • EC 2.7.11.13
  • PAK2
  • Pak-2
  • PKN2
  • PRK2
  • PRK2MGC150606
  • PRKCL2
  • PRKCL2PRO2042
  • PRO2042
  • Protein kinase C-like 2MGC71074
  • protein kinase N2
  • Protein-kinase C-related kinase 2
  • serine/threonine-protein kinase N2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-2901
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for PKN2 Antibody (NBP2-13766) (0)

There are no publications for PKN2 Antibody (NBP2-13766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKN2 Antibody (NBP2-13766) (0)

There are no reviews for PKN2 Antibody (NBP2-13766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKN2 Antibody (NBP2-13766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKN2 Products

Bioinformatics Tool for PKN2 Antibody (NBP2-13766)

Discover related pathways, diseases and genes to PKN2 Antibody (NBP2-13766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKN2 Antibody (NBP2-13766)

Discover more about diseases related to PKN2 Antibody (NBP2-13766).
 

Pathways for PKN2 Antibody (NBP2-13766)

View related products by pathway.

PTMs for PKN2 Antibody (NBP2-13766)

Learn more about PTMs related to PKN2 Antibody (NBP2-13766).
 

Research Areas for PKN2 Antibody (NBP2-13766)

Find related products by research area.

Blogs on PKN2

There are no specific blogs for PKN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKN2
Entrez