PKN2 Antibody


Western Blot: PKN2 Antibody [NBP2-13766] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PKN2 Antibody [NBP2-13766] - Staining of human kidney shows strong cytoplasmic positivity in glomeruli.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PKN2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKD RI
Specificity of human, mouse, rat PKN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
PKN2 Lysate (NBP2-64967)
Control Peptide
PKN2 Protein (NBP2-13766PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PKN2 Antibody

  • cardiolipin-activated protein kinase Pak2
  • EC 2.7.11
  • EC
  • PAK2
  • Pak-2
  • PKN2
  • PRK2
  • PRK2MGC150606
  • PRKCL2
  • PRKCL2PRO2042
  • PRO2042
  • Protein kinase C-like 2MGC71074
  • protein kinase N2
  • Protein-kinase C-related kinase 2
  • serine/threonine-protein kinase N2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P

Publications for PKN2 Antibody (NBP2-13766) (0)

There are no publications for PKN2 Antibody (NBP2-13766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKN2 Antibody (NBP2-13766) (0)

There are no reviews for PKN2 Antibody (NBP2-13766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKN2 Antibody (NBP2-13766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PKN2 Products

Bioinformatics Tool for PKN2 Antibody (NBP2-13766)

Discover related pathways, diseases and genes to PKN2 Antibody (NBP2-13766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKN2 Antibody (NBP2-13766)

Discover more about diseases related to PKN2 Antibody (NBP2-13766).

Pathways for PKN2 Antibody (NBP2-13766)

View related products by pathway.

PTMs for PKN2 Antibody (NBP2-13766)

Learn more about PTMs related to PKN2 Antibody (NBP2-13766).

Research Areas for PKN2 Antibody (NBP2-13766)

Find related products by research area.

Blogs on PKN2

There are no specific blogs for PKN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PKN2 Antibody and receive a gift card or discount.


Gene Symbol PKN2