PKM2 Recombinant Protein Antigen

Images

 
There are currently no images for PKM2 Protein (NBP1-82487PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKM.

Source: E. coli

Amino Acid Sequence: TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PKM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82487.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKM2 Recombinant Protein Antigen

  • CTHBP
  • Cytosolic thyroid hormone-binding protein
  • MGC3932
  • OIP3
  • OIP-3
  • OIP3EC 2.7.1.40
  • Opa-interacting protein 3
  • p58
  • PK, muscle type
  • PK2
  • PK3
  • PK3PKM
  • PKM2
  • Pyruvate kinase 2/3
  • pyruvate kinase isozymes M1/M2
  • Pyruvate kinase muscle isozyme
  • pyruvate kinase, muscle
  • TCB
  • THBP1
  • THBP1p58
  • Thyroid hormone-binding protein 1
  • thyroid hormone-binding protein, cytosolic
  • Tumor M2-PK

Background

PKM2 is encoded by this gene is a pyruvate kinase that catalyzes the production of phosphoenolpyruvate from pyruvate and ATP. This protein has been shown to interact with thyroid hormone, and thus may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-43853
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1209
Species: Hu
Applications: WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NBP1-62583
Species: Hu
Applications: WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NBP1-45218
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4655
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP

Publications for PKM2 Protein (NBP1-82487PEP) (0)

There are no publications for PKM2 Protein (NBP1-82487PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKM2 Protein (NBP1-82487PEP) (0)

There are no reviews for PKM2 Protein (NBP1-82487PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKM2 Protein (NBP1-82487PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKM2 Products

Research Areas for PKM2 Protein (NBP1-82487PEP)

Find related products by research area.

Blogs on PKM2.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

5 Stars for the PKM2 Antibody
Novus' Pyruvate Kinase M2 antibody (cat # NBP1-48308) has received some glowing product reviews and customer feedback lately. One satisfied customer wrote, "The best thing about this antibody is that it works well for immunofluorescence staining of fr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKM2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PKM