PKLR Antibody - BSA Free

Western Blot: PKLR Antibody [NBP1-56319] - HepG2 cell lysate, concentration 1.0ug/ml.

Immunohistochemistry-Paraffin: PKLR Antibody [NBP1-56319] - Human kidney lysate tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

PKLR Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PKLR(pyruvate kinase, liver and RBC) The peptide sequence was selected from the N terminal of PKLR (NP_870986). Peptide sequence STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKLR
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22367961).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for PKLR Antibody - BSA Free

• EC 2.7.1.40
• PK1
• PK1PKRL
• PKL
• PKLR
• PKR
• Pyruvate Kinase 1
• pyruvate kinase isozyme R/L
• pyruvate kinase isozymes R/L
• pyruvate kinase type L
• pyruvate kinase, liver and blood cell
• pyruvate kinase, liver and RBC
• Red cell/liver pyruvate kinase
• RPK
• R-type/L-type pyruvate kinase

Background

PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).The protein encoded by this gene is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PKLR Antibody (NBP1-56319)(1)

Publication using NBP1-56319

• Kowalski, W, Nocon, D, Gamian, A et al. Association of C-terminal region of phosphoglycerate mutase with glycolytic complex regulates energy production in cancer cells J Cell Physiol 2012-01-01 [PMID: 22367961] (Mouse)

Bioinformatics

• Gene Symbol: PKLR
• Entrez:
  • 5313(Human)
• Uniprot:
  • P30613-2(Human)