PKDREJ Antibody - BSA Free

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining in human testis and placenta tissues using anti-PKDREJ antibody. Corresponding PKDREJ RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: PKDREJ Antibody [NBP1-86318] - Staining of human placenta shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKDREJ Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKDREJ Antibody - BSA Free (NBP1-86318) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPVYEEPSDEVEAMTYLCRKLRTMFSFLTSQSKAKDEPEFFIDMLYGQPEKNSHRYLGLKTRNINGKKMVYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKDREJ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PKDREJ Protein (NBP1-86318PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PKDREJ Antibody - BSA Free

• PKD and REJ homolog
• polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin)

Background

PKDREJ encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined.; FUNCTION: May have a central role in fertilization. May generate a Ca(2+) transporting channel directly involved in initiating the acrosome reaction of the sperm. SUBUNIT: May form homomultimers or heteromultimers in combination with an as yet unidentified subunits. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Exclusively expressed in testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKDREJ