PKD2L2 Antibody

Images

 
Western Blot: PKD2L2 Antibody [NBP2-47332] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: PKD2L2 Antibody [NBP2-47332] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry: PKD2L2 Antibody [NBP2-47332] - Staining of human lymph node shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKD2L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVS
Specificity
Specificity of human PKD2L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKD2L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKD2L2 Protein (NBP2-47332PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKD2L2 Antibody

  • polycystic kidney disease 2-like 2 protein
  • polycystic kidney disease 2-like 2
  • polycystin-L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83791
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-82375
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP1-86318
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47332
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PKD2L2 Antibody (NBP2-47332) (0)

There are no publications for PKD2L2 Antibody (NBP2-47332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKD2L2 Antibody (NBP2-47332) (0)

There are no reviews for PKD2L2 Antibody (NBP2-47332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKD2L2 Antibody (NBP2-47332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PKD2L2 Antibody (NBP2-47332)

Discover related pathways, diseases and genes to PKD2L2 Antibody (NBP2-47332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKD2L2 Antibody (NBP2-47332)

Discover more about diseases related to PKD2L2 Antibody (NBP2-47332).
 

Pathways for PKD2L2 Antibody (NBP2-47332)

View related products by pathway.

Blogs on PKD2L2

There are no specific blogs for PKD2L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKD2L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD2L2