PKD2L1 Antibody - BSA Free

Western Blot: PKD2L1 Antibody [NBP2-86748] - Host: Rabbit. Target Name: PKD2L1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PKD2L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKD2L1 Antibody - BSA Free (NBP2-86748) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PKD2L1. Peptide sequence: QKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQETAY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKD2L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PKD2L1 Antibody - BSA Free

• PCL
• PKD2L
• PKD2L1
• PKD2Lpolycystin-L
• PKDL
• PKDLpolycystin-L1
• polycystic kidney disease 2-like 1 protein
• polycystic kidney disease 2-like 1
• Polycystin-2 homolog
• Polycystin-2L1
• Polycystin-L
• Polycystin-L1
• transient receptor potential cation channel, subfamily P, member 3
• TRPP3

Background

PKD2L1 encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined; FUNCTION: May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in adult heart, skeletal muscle, brain, spleen, testis, retina and liver. According to Ref.1 expressed at high levels in fetal tissues, including kidney and liver, and down-regulated in adult tissues. It has been found to be expressed in fetal brain, but not expressed in fetal lung, liver or kidney. Isoform 4 appears to be expressed only in transformed lymphoblasts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKD2L1