PKC iota Antibody

Images

 
Western Blot: PKC iota Antibody [NBP1-84959] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: PKC iota Antibody [NBP1-84959] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PKC iota Antibody [NBP1-84959] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: PKC iota Antibody [NBP1-84959] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKC iota Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKCI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC iota Protein (NBP1-84959PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKC iota Antibody

  • aPKC-lambda/iota
  • Atypical protein kinase C-lambda/iota
  • DXS1179E
  • EC 2.7.11
  • EC 2.7.11.13
  • MGC26534
  • nPKC-iota
  • PKCI
  • PRKC-lambda/iota
  • protein kinase C iota type
  • protein kinase C, iota

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
MAB5018
Species: Hu
Applications: WB, IP
AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PKC iota Antibody (NBP1-84959) (0)

There are no publications for PKC iota Antibody (NBP1-84959).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC iota Antibody (NBP1-84959) (0)

There are no reviews for PKC iota Antibody (NBP1-84959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC iota Antibody (NBP1-84959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC iota Products

Bioinformatics Tool for PKC iota Antibody (NBP1-84959)

Discover related pathways, diseases and genes to PKC iota Antibody (NBP1-84959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC iota Antibody (NBP1-84959)

Discover more about diseases related to PKC iota Antibody (NBP1-84959).
 

Pathways for PKC iota Antibody (NBP1-84959)

View related products by pathway.

PTMs for PKC iota Antibody (NBP1-84959)

Learn more about PTMs related to PKC iota Antibody (NBP1-84959).
 

Research Areas for PKC iota Antibody (NBP1-84959)

Find related products by research area.

Blogs on PKC iota

There are no specific blogs for PKC iota, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC iota Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCI