PKC gamma Antibody

Images

 
Western Blot: PKC gamma Antibody [NBP1-58916] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Chromatin Immunoprecipitation: PKC gamma Antibody [NBP1-58916] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and ...read more
Western Blot: PKC gamma Antibody [NBP1-58916] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB, ChIP, ICC/IF, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKC gamma Antibody Summary

Immunogen
Synthetic peptides corresponding to PRKCG(protein kinase C, gamma) The peptide sequence was selected from the N terminal of PRKCG. Peptide sequence FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKCG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Chromatin Immunoprecipitation 1:10-1:500
  • Immunocytochemistry/Immunofluorescence
  • Chromatin Immunoprecipitation (ChIP)
Application Notes
This is a rabbit polyclonal antibody against PRKCG and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-58916 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PKC gamma Antibody

  • EC 2.7.11
  • EC 2.7.11.13
  • MGC57564
  • PKC gamma
  • PKCC
  • PKCCSCA14
  • PKCG
  • PKC-gamma
  • PKCGprotein kinase C gamma type
  • PRKCG
  • protein kinase C, gamma
  • SCA14

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fi, Rb, Sh, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-19846
Species: Hu, Rt, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87270
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NB110-58346
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD

Publications for PKC gamma Antibody (NBP1-58916) (0)

There are no publications for PKC gamma Antibody (NBP1-58916).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PKC gamma Antibody (NBP1-58916) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-58916:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PKC gamma NBP1-58916
Enlarge
5
reviewed by:
Daniel Popoola
WB Rat 03/21/2017
View

Summary

ApplicationWestern Blot
Sample Tested brain
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for PKC gamma Antibody (NBP1-58916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKC gamma Products

Bioinformatics Tool for PKC gamma Antibody (NBP1-58916)

Discover related pathways, diseases and genes to PKC gamma Antibody (NBP1-58916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC gamma Antibody (NBP1-58916)

Discover more about diseases related to PKC gamma Antibody (NBP1-58916).
 

Pathways for PKC gamma Antibody (NBP1-58916)

View related products by pathway.

PTMs for PKC gamma Antibody (NBP1-58916)

Learn more about PTMs related to PKC gamma Antibody (NBP1-58916).
 

Research Areas for PKC gamma Antibody (NBP1-58916)

Find related products by research area.

Blogs on PKC gamma

There are no specific blogs for PKC gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Daniel Popoola
03/21/2017
Application: WB
Species: Rat

Bioinformatics

Gene Symbol PRKCG
Uniprot