PKC delta Antibody (2E12.)

Images

 
Western Blot: PKC delta Antibody (1E12) [H00005580-M06] - Western Blot analysis of PRKCD expression in A-431 ( Cat # L015V1 ).
Immunocytochemistry/ Immunofluorescence: PKC delta Antibody (1E12) [H00005580-M06] - Analysis of monoclonal antibody to PRKCD on A-431 cell. Antibody concentration 10 ug/ml
ELISA: PKC delta Antibody (1E12) [H00005580-M06] - Detection limit for recombinant GST tagged PRKCD is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKC delta Antibody (2E12.) Summary

Immunogen
PRKCD (NP_006245 577 a.a. - 676 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Localization
Cytoplasmic
Specificity
PRKCD - protein kinase C, delta
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKCD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00005580-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKC delta Antibody (2E12.)

  • EC 2.7.11
  • EC 2.7.11.13
  • MAY1
  • MGC49908
  • nPKC-delta
  • PKC delta
  • PKCD
  • PRKCD
  • protein kinase C delta type
  • protein kinase C delta VIII
  • protein kinase C, delta

Background

Protein Kinase C delta (PKC delta) is a 78 kDa member of the novel group (nPKCs: sensitive to diacylglycerol, phosphatidylserine, and phorbol esters) of the PKC family of serine/threonine kinases that are involved in a wide range of physiological processes including mitogenesis, cell survival and transcriptional regulation. PKC delta is an ubiquitously expressed PKC isozyme that has been implicated in the regulation of multiple cellular processes including cell cycle progression and apoptosis. Autophosphorylation of serine 664 (serine 662 in mouse and rat) contributes to PKC delta activity. Serum dependent phosphorylation of serine 664 is mediated by mTOR pathway, is protected from dephosphorylation by phosphorylated threonine 505 in the activation loop, and is implicated in prolactin signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
AF5134
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for PKC delta Antibody (H00005580-M06)(1)

Reviews for PKC delta Antibody (H00005580-M06) (0)

There are no reviews for PKC delta Antibody (H00005580-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC delta Antibody (H00005580-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC delta Products

Bioinformatics Tool for PKC delta Antibody (H00005580-M06)

Discover related pathways, diseases and genes to PKC delta Antibody (H00005580-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC delta Antibody (H00005580-M06)

Discover more about diseases related to PKC delta Antibody (H00005580-M06).
 

Pathways for PKC delta Antibody (H00005580-M06)

View related products by pathway.

PTMs for PKC delta Antibody (H00005580-M06)

Learn more about PTMs related to PKC delta Antibody (H00005580-M06).
 

Research Areas for PKC delta Antibody (H00005580-M06)

Find related products by research area.

Blogs on PKC delta

There are no specific blogs for PKC delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC delta Antibody (2E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCD
Entrez
OMIM
Uniprot