Recombinant Human PJA2/Praja2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PJA2/Praja2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 302-400 of Human PJA2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PJA2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PJA2/Praja2 Protein

  • E3 ubiquitin-protein ligase Praja-2
  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0438praja2
  • Neurodap1
  • praja ring finger 2
  • Praja2
  • RING finger protein 131praja 2, RING-H2 motif containing
  • RNF131

Background

PJA2 - praja 2, RING-H2 motif containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46270
Species: Hu
Applications: WB, IHC
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB

Publications for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01) (0)

There are no publications for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01) (0)

There are no reviews for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PJA2/Praja2 Products

Bioinformatics Tool for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01)

Discover related pathways, diseases and genes to PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01)

Discover more about diseases related to PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01).
 

Pathways for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01)

View related products by pathway.

PTMs for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01)

Learn more about PTMs related to PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01).
 

Research Areas for PJA2/Praja2 Partial Recombinant Protein (H00009867-Q01)

Find related products by research area.

Blogs on PJA2/Praja2

There are no specific blogs for PJA2/Praja2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-6 [Unconjugated]
507-BP-020/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PJA2/Praja2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PJA2