Recombinant Human PITX2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PITX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 60-159 of Human PITX2

Source: Wheat Germ

Amino Acid Sequence: RNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PITX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PITX2 Protein

  • all1-responsive gene 1
  • ALL1-responsive protein ARP1
  • ARP1MGC20144
  • Brx1
  • Homeobox protein PITX2
  • IDG2
  • IGDS
  • IGDS2
  • IHG2
  • IRID2
  • Otlx2
  • paired-like homeodomain 2
  • Paired-like homeodomain transcription factor 2MGC111022
  • pituitary homeo box 2
  • pituitary homeobox 2
  • PITX2
  • PTX2
  • RGS
  • RGSRIEG1Brx1
  • rieg bicoid-related homeobox transcription factor 1
  • RIEG bicoid-related homeobox transcription factor
  • RIEG
  • RIEG1
  • RP1
  • RS
  • Solurshin

Background

PITX2 - paired-like homeodomain transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, Flow, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
MAB994
Species: Mu
Applications: WB
H00005308-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PITX2 Partial Recombinant Protein (H00005308-Q01) (0)

There are no publications for PITX2 Partial Recombinant Protein (H00005308-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX2 Partial Recombinant Protein (H00005308-Q01) (0)

There are no reviews for PITX2 Partial Recombinant Protein (H00005308-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX2 Partial Recombinant Protein (H00005308-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PITX2 Products

Bioinformatics Tool for PITX2 Partial Recombinant Protein (H00005308-Q01)

Discover related pathways, diseases and genes to PITX2 Partial Recombinant Protein (H00005308-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX2 Partial Recombinant Protein (H00005308-Q01)

Discover more about diseases related to PITX2 Partial Recombinant Protein (H00005308-Q01).
 

Pathways for PITX2 Partial Recombinant Protein (H00005308-Q01)

View related products by pathway.

PTMs for PITX2 Partial Recombinant Protein (H00005308-Q01)

Learn more about PTMs related to PITX2 Partial Recombinant Protein (H00005308-Q01).
 

Research Areas for PITX2 Partial Recombinant Protein (H00005308-Q01)

Find related products by research area.

Blogs on PITX2

There are no specific blogs for PITX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PITX2 Antibody (2G6)
H00005308-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PITX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX2
Entrez