PITPNB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PITPNB Antibody [NBP1-86864] - Staining of human cell line U-2 OS shows localization to cytosol & vesicles.

Immunohistochemistry-Paraffin: PITPNB Antibody [NBP1-86864] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITPNB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITPNB Antibody - BSA Free (NBP1-86864) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PITPNB Protein (NBP1-86864PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PITPNB Antibody - BSA Free

• phosphatidylinositol transfer protein beta isoform
• phosphatidylinositol transfer protein, beta
• phosphotidylinositol transfer protein, beta
• PI-TP-beta
• PtdIns transfer protein beta
• PtdInsTP beta
• PtdInsTP
• VIB1B

Background

PITPNB, also known as Phosphatidylinositol Transfer Protein Beta, has two isoforms that are each approximately 32 kDa with 271 and 272 amino acids, respectively. PITPNB is localized to the cytoplasm and expressed in a variety of tissues, including the brain. PITPNB is responsible for catalyzing the transfer of phosphatidylcholine and phosphatidylinositol between membranes. Pathways in which PITPNB plays a role include phospholipid metabolism and PI/PC transport between the ER and Golgi membranes. Current research on PITPNB is being conducted in relation to obesity, and PITPNB has been shown to interact with Von Hippel Lindau, Ubiquitin C, Lamin A and LMO4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNB