PITPNB Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PITPNB Antibody - BSA Free (NBP1-86864) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PITPNB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PITPNB Antibody - BSA Free
Background
PITPNB, also known as Phosphatidylinositol Transfer Protein Beta, has two isoforms that are each approximately 32 kDa with 271 and 272 amino acids, respectively. PITPNB is localized to the cytoplasm and expressed in a variety of tissues, including the brain. PITPNB is responsible for catalyzing the transfer of phosphatidylcholine and phosphatidylinositol between membranes. Pathways in which PITPNB plays a role include phospholipid metabolism and PI/PC transport between the ER and Golgi membranes. Current research on PITPNB is being conducted in relation to obesity, and PITPNB has been shown to interact with Von Hippel Lindau, Ubiquitin C, Lamin A and LMO4.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow
Publications for PITPNB Antibody (NBP1-86864) (0)
There are no publications for PITPNB Antibody (NBP1-86864).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PITPNB Antibody (NBP1-86864) (0)
There are no reviews for PITPNB Antibody (NBP1-86864).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PITPNB Antibody (NBP1-86864) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PITPNB Products
Blogs on PITPNB