AGXT2L1 Antibody - BSA Free

Western Blot: AGXT2L1 Antibody [NBP1-91655] - Analysis in control (vector only transfected HEK293T lysate) and ETNPPL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: AGXT2L1 Antibody [NBP1-91655] - Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: AGXT2L1 Antibody [NBP1-91655] - Analysis in human kidney and skeletal muscle tissue. Corresponding RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AGXT2L1 Antibody [NBP1-91655] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.

Analysis in control (vector only transfected HEK293T lysate) and ETNPPL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Analysis in human kidney and skeletal muscle tissues using NBP1-91655 antibody. Corresponding ETNPPL RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes.

Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGXT2L1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGXT2L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  AGXT2L1 Recombinant Protein Antigen (NBP1-91655PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGXT2L1 Antibody - BSA Free

• alanine--glyoxylate aminotransferase 2-like 1
• alanine-glyoxylate aminotransferase 2-like 1
• EC 2.6.1
• EC 2.6.1.-
• EC 2.6.1.11
• EC 2.6.1.44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGXT2L1
• Entrez:
  • 64850(Human)
• Uniprot:
  • Q8TBG4(Human)