PIK3R5 Antibody - BSA Free

Western Blot: PIK3R5 Antibody [NBP1-56922] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: PIK3R5 Antibody [NBP1-56922] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Western Blot: PIK3R5 Antibody [NBP1-56922] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Western Blot: PIK3R5 Antibody [NBP1-56922] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIK3R5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PIK3R5(phosphoinositide-3-kinase, regulatory subunit 5) The peptide sequence was selected from the N terminal of PIK3R5. Peptide sequence HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 5.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3R5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33608310).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIK3R5 Antibody - BSA Free

• F730038I15Rik
• FOAP-2
• p101
• p101-PI3K
• Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit
• phosphoinositide-3-kinase, regulatory subunit 5
• phosphoinositide-3-kinase, regulatory subunit, polypeptide p101
• PI3-kinase p101 subunit
• PI3-kinase regulatory subunit 5
• PIK3R5
• PtdIns-3-kinase regulatory subunit
• regulatory subunit 5, p101

Background

Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit (Brock et al., 2003 [PubMed 12507995]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3253 AF128881.1 1-3253

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIK3R5 Antibody (NBP1-56922)(1)

Publication using NBP1-56922

• Terasaki M, Inoue T, Murase W et al. A Fucoxanthinol Induces Apoptosis in a Pancreatic Intraepithelial Neoplasia Cell Cancer genomics & proteomics 2021-12-10 [PMID: 33608310] (WB, Mouse)

Bioinformatics

• Gene Symbol: PIK3R5
• Uniprot:
  • Q8WYR1(Human)