PIK3C2G Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PIK3C2G Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIK3C2G
  
  

  Source: E.coli

  Amino Acid Sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PIK3C2G
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25052It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIK3C2G Recombinant Protein Antigen

• EC 2.7.1
• EC 2.7.1.154
• MGC163149
• phosphatidylinositol 3-kinase C2 domain-containing gamma
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing gammapolypeptide
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma
• Phosphoinositide 3-kinase-C2-gamma
• phosphoinositide-3-kinase, class 2, gamma polypeptide
• PI3K-C2GAMMA
• PI3K-C2-gamma
• PIK3C2G
• PTDINS-3-kinase C2 gamma
• PtdIns-3-kinase C2 subunit gamma

Background

PIK3C2G, also known as Phosphatidylinositol-4-Phosphate 3-Kinase, Catalytic Subunit Type 2 Gamma, is 1,485 amino acids long and approximately 171 kDa. PIK3C2G belongs to the PI 3-Kinase family. Although little is known about the function of PIK3C2G, PI3K family members play a role in the regulation of intracellular trafficking, cell survival and proliferation, and oncogenesis. PIK3C2G research is currently being conducted in relation to several diseases and disorders such as alcoholism, schizophrenia and Kaposi's sarcoma. PIK3C2G has been shown to have interactions with other PI3/PI4-kinase members such as PI4KA, PI4KB, PI4K2A, PI4K2B and PIP5K1B in pathways including the mTOR pathway, TGF-beta Pathway, NF-kappaB Pathway and Phosphatidylinositol signaling system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3C2G