PIGP Antibody - BSA Free

Western Blot: PIGP Antibody [NBP2-85475] - Host: Rabbit. Target Name: PIGP. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIGP Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PIGP. Peptide sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIGP Antibody - BSA Free

• class P
• DCRCDown syndrome critical region protein C
• Down syndrome critical region protein 5
• DSCR5DCRC-S
• DSCRC
• DSRC
• EC 2.4.1.198
• phosphatidylinositol glycan anchor biosynthesis, class P
• Phosphatidylinositol-glycan biosynthesis class P protein
• phosphatidylinositol-n-acetylglucosaminyltranferase subunit
• PIG-P

Background

The PIGP gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a compone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGP