PIGP Antibody

Images

 
Western Blot: PIGP Antibody [NBP2-85475] - Host: Rabbit. Target Name: PIGP. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PIGP. Peptide sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PIGP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGP Antibody

  • class P
  • DCRCDown syndrome critical region protein C
  • Down syndrome critical region protein 5
  • DSCR5DCRC-S
  • DSCRC
  • DSRC
  • EC 2.4.1.198
  • phosphatidylinositol glycan anchor biosynthesis, class P
  • Phosphatidylinositol-glycan biosynthesis class P protein
  • phosphatidylinositol-n-acetylglucosaminyltranferase subunit
  • PIG-P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83342
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86283
Species: Hu
Applications: IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
H00009091-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38056
Species: Hu
Applications: IHC, IHC-P
AF5414
Species: Hu
Applications: Simple Western, WB
NBP1-87697
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00053820-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF198
Species: Mu
Applications: IHC, WB
NBP2-85475
Species: Hu
Applications: WB

Publications for PIGP Antibody (NBP2-85475) (0)

There are no publications for PIGP Antibody (NBP2-85475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGP Antibody (NBP2-85475) (0)

There are no reviews for PIGP Antibody (NBP2-85475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGP Antibody (NBP2-85475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGP Products

Bioinformatics Tool for PIGP Antibody (NBP2-85475)

Discover related pathways, diseases and genes to PIGP Antibody (NBP2-85475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGP Antibody (NBP2-85475)

Discover more about diseases related to PIGP Antibody (NBP2-85475).
 

Pathways for PIGP Antibody (NBP2-85475)

View related products by pathway.

PTMs for PIGP Antibody (NBP2-85475)

Learn more about PTMs related to PIGP Antibody (NBP2-85475).

Blogs on PIGP

There are no specific blogs for PIGP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGP