Home » PIGP » PIGP Antibodies » PIGP Antibody

PIGP Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PIGP Antibody [NBP2-85475] - Host: Rabbit. Target Name: PIGP. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: PIGP Antibody [NBP2-85475] - Host: Rabbit. Target Name: PIGP. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PIGP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PIGP. Peptide sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PIGP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIGP Antibody

  • class P
  • DCRCDown syndrome critical region protein C
  • Down syndrome critical region protein 5
  • DSCR5DCRC-S
  • DSCRC
  • DSRC
  • EC 2.4.1.198
  • phosphatidylinositol glycan anchor biosynthesis, class P
  • Phosphatidylinositol-glycan biosynthesis class P protein
  • phosphatidylinositol-n-acetylglucosaminyltranferase subunit
  • PIG-P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GNPDA1 Antibody
NBP2-24653
Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.
Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PIGH Antibody
NBP1-83342
Western Blot: PIGH Antibody [NBP1-83342] - Analysis in control (vector only transfected HEK293T lysate) and PIGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PIGH Antibody [NBP1-83342] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: PIGH Antibody [NBP1-83342] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
PIGC Antibody
NBP1-86283
Immunohistochemistry: PIGC Antibody [NBP1-86283] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Western Blot: PIGC Antibody [NBP1-86283] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Species: Hu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
PIGA Antibody
NBP2-13760
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human gallbladder shows granulated cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Duodenum shows strong granular cytoplasmic positivity in goblet cells.
Immunohistochemistry-Paraffin: PIGA Antibody [NBP2-13760] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P
PIGQ Antibody (2B7)
H00009091-M02
Immunohistochemistry-Paraffin: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of monoclonal antibody to PIGQ on formalin-fixed paraffin-embedded human placenta. Antibody concentration 4 ug/ml.
Western Blot: PIGQ Antibody (2B7) [H00009091-M02] - Analysis of PIGQ expression in transfected 293T cell line by PIGQ monoclonal antibody (M02), clone 2B7.Lane 1: PIGQ transfected lysate(84.1 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: PIGQ Antibody (2B7) [H00009091-M02] - Detection limit for recombinant GST tagged PIGQ is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P, WB
KMT2B Antibody
NB300-864
Immunohistochemistry-Paraffin: KMT2B Antibody [NB300-864] - (5ug/ml) staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: KMT2B Antibody [NB300-864] - (5ug/ml) staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Epididymis shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Rectum shows strong membranous and cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
DHPS Antibody
NBP1-82648
Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.
Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPM2 Antibody
NBP2-38056
Immunohistochemistry: DPM2 Antibody [NBP2-38056] - Staining of human esophagus shows moderate nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Glypican 4 Antibody
NBP1-87697
Immunocytochemistry/Immunofluorescence: Glypican 4 Antibody [NBP1-87697] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glypican 4 Antibody [NBP1-87697] - Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.
Immunohistochemistry-Paraffin: Glypican 4 Antibody [NBP1-87697] - Staining of human liver shows strong positivity in cytoplasm granular in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
KMT2D Antibody
NBP1-89123
Immunocytochemistry/Immunofluorescence: KMT2D Antibody [NBP1-89123] - Staining of human cell line A-431 shows localization to nucleus, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KMT2D Antibody [NBP1-89123] - Staining of human cervix, uterine shows weak nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: KMT2D Antibody [NBP1-89123] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
KCNE1 Antibody
(5B12)
H00003753-M01
ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: Non-transfected lysate.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(2 Publications)
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
IRS1 Antibody
(OTI3G10)
NBP2-45435
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: IRS1 Antibody (3G10) [NBP2-45435] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Recombinant Human
DSCR6 GST (N-Term) Pr ...
H00053820-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Frizzled-7
Antibody [Unconjugate
AF198
Frizzled‑7 was detected in immersion fixed frozen sections of embryonic mouse gastrointestinal tract (11 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Frizzled‑7 at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Mu
Applications: IHC, WB
PIGP Antibody
NBP2-85475
PIGP Antibody
Species: Hu
Applications: WB

Publications for PIGP Antibody (NBP2-85475) (0)

There are no publications for PIGP Antibody (NBP2-85475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGP Antibody (NBP2-85475) (0)

There are no reviews for PIGP Antibody (NBP2-85475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGP Antibody (NBP2-85475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGP Products

Bioinformatics Tool for PIGP Antibody (NBP2-85475)

Discover related pathways, diseases and genes to PIGP Antibody (NBP2-85475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGP Antibody (NBP2-85475)

Discover more about diseases related to PIGP Antibody (NBP2-85475).
 

Pathways for PIGP Antibody (NBP2-85475)

View related products by pathway.

PTMs for PIGP Antibody (NBP2-85475)

Learn more about PTMs related to PIGP Antibody (NBP2-85475).

Blogs on PIGP

There are no specific blogs for PIGP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGP Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PIGP