PIGL Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIGL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PIGL Antibody - BSA Free
Background
PIGL, also referred to as N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, is approximately 29 kDa and 252 amino acids in length. PIGL localizes to the endoplasmic reticulum and is an important player the synthesis of GPI anchors as it catalyzes the second step in the reaction. Current research on PIGL is being performed relating to several diseases and disorders including congenital heart disease, babesiosis, ear anomalies syndrome, ichthyosiform dermatosis, malaria and sleeping sickness. PIGL has also been shown to have interactions with PIGA, PIGC, PIGH, DPM2, and GPLD1 in pathways such as GPI anchor biosynthesis and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC
Publications for PIGL Antibody (NBP1-86471) (0)
There are no publications for PIGL Antibody (NBP1-86471).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIGL Antibody (NBP1-86471) (0)
There are no reviews for PIGL Antibody (NBP1-86471).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIGL Antibody (NBP1-86471) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIGL Products
Blogs on PIGL