PIGA Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PIGA. Peptide sequence: NHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIGA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PIGA Antibody - BSA Free
Background
PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: WB
Publications for PIGA Antibody (NBP2-87967) (0)
There are no publications for PIGA Antibody (NBP2-87967).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIGA Antibody (NBP2-87967) (0)
There are no reviews for PIGA Antibody (NBP2-87967).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIGA Antibody (NBP2-87967) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIGA Products
Research Areas for PIGA Antibody (NBP2-87967)
Find related products by research area.
|
Blogs on PIGA