PICK1 Antibody

Images

 
Immunohistochemistry-Paraffin: PICK1 Antibody [NBP2-57605] - Immunohistochemical staining of human testis shows strong cytoplsamic positivity in a subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PICK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTA
Specificity
Specificity of human PICK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PICK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PICK1 Recombinant Protein Antigen (NBP2-57605PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PICK1 Antibody

  • alpha binding protein
  • dJ1039K5
  • MGC15204
  • PICK
  • PRKCA-binding protein
  • PRKCABPprotein interacting with PRKCA
  • Protein interacting with C kinase 1
  • protein interacting with PRKCA 1
  • Protein kinase C-alpha-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-76909
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-14321
Species: Hu
Applications: WB, IHC, IHC-P
AF2656
Species: Hu
Applications: WB, IHC
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NLS921
Species: Hu, Bv
Applications: WB, IHC, IHC-P, ICC
NB300-171
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-57605
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PICK1 Antibody (NBP2-57605) (0)

There are no publications for PICK1 Antibody (NBP2-57605).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PICK1 Antibody (NBP2-57605) (0)

There are no reviews for PICK1 Antibody (NBP2-57605). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PICK1 Antibody (NBP2-57605). (Showing 1 - 1 of 1 FAQ).

  1. Here is a difficult request. We are looking for an antibody with the following specifications: Anti-PICK1 Reactive in mouse without sodium azide, so it can be injected into the mouse without compromising its life With PBS (for example) It does not necessarily have to be guaranteed. Have you got anything like it?
    • Unfortunately all of our anti-PICK1 mouse-reactive antibodies are supplied in sodium azide. We do have anti human PICK1 without preservatives, but that would not be suitable if you are working with mouse samples. NB100-41403 contains only 0.02% sodium azide which is the lowest percentage. We also offer an Antibody Concentration and Clean Up Antibody Purification Kit which can be used to reduce the concentration of unwanted additives often found in antibody formulations, such as sodium azide, glycine or tris. This kit is offered in two sizes: cat# 861-0005 includes 1 column and cat# 861-0010 includes 3 columns.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PICK1 Products

Bioinformatics Tool for PICK1 Antibody (NBP2-57605)

Discover related pathways, diseases and genes to PICK1 Antibody (NBP2-57605). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PICK1 Antibody (NBP2-57605)

Discover more about diseases related to PICK1 Antibody (NBP2-57605).
 

Pathways for PICK1 Antibody (NBP2-57605)

View related products by pathway.

PTMs for PICK1 Antibody (NBP2-57605)

Learn more about PTMs related to PICK1 Antibody (NBP2-57605).
 

Research Areas for PICK1 Antibody (NBP2-57605)

Find related products by research area.

Blogs on PICK1

There are no specific blogs for PICK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PICK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PICK1