PICALM Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PICALM Antibody [NBP1-86659] - Staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining in human placenta and skeletal muscle tissues using NBP1-86659 antibody. Corresponding PICALM RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining of human cerebellum, duodenum, placenta and skeletal muscle using Anti-PICALM antibody NBP1-86659 (A) shows similar protein distribution across tissues to independent antibody NBP1-86658 (B).

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86659] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell lines Caco-2 and PC-3 using Anti-PICALM antibody. Corresponding PICALM RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PICALM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PICALM Antibody - BSA Free (NBP1-86659) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PICALM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PICALM Protein (NBP1-86659PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PICALM Antibody - BSA Free

• CALMclathrin assembly lymphoid-myeloid leukemia
• Clathrin assembly lymphoid myeloid leukemia protein
• CLTHphosphatidylinositol-binding clathrin assembly protein
• LAP
• phosphatidylinositol binding clathrin assembly protein

Background

Assembly protein recruiting clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. May be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. Involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PICALM