PIBF1 Recombinant Protein Antigen

Images

 
There are currently no images for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIBF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIBF1.

Source: E. coli

Amino Acid Sequence: QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIBF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56805.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIBF1 Recombinant Protein Antigen

  • C13orf24
  • chromosome 13 open reading frame 24
  • KIAA1008
  • PIBF
  • PIBF1
  • progesterone immunomodulatory binding factor 1
  • progesterone-induced blocking factor 1
  • progesterone-induced-blocking factor 1
  • RP11-505F3.1

Background

PIBF (progesterone-induced blocking factor 1) is synthesized during pregnancy in response to progesterone by progesterone receptor-positive T lymphocytes (mostly gamma-delta T cells). In the presence of PIBF, natural killer (NK) cells inhibit the release of perforin from storage granules and, therefore, fail to lyse target cells. In humans, the amount of cells that express PIBF is significantly higher in healthy pregnant women than in women at risk for premature pregnancy termination. PIBF has a predicted 89 kDa molecular mass; the full-length PIBF is associated with the nucleus, whereas secretion of shorter forms, such a 34 kDa protein is induced by activation of the cell. Research suggests that PIBF functions as a transcription factor in its full-length form, while smaller forms may act as cytokines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY417
Species: Mu
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
MAB4260
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB500-302
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
203-IL
Species: Hu
Applications: BA
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB500-597
Species: Hu, Mu, Rt
Applications: Flow, IP, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF745
Species: Mu
Applications: Block, WB

Publications for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP) (0)

There are no publications for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP) (0)

There are no reviews for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIBF1 Recombinant Protein Antigen (NBP2-56805PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIBF1 Products

Blogs on PIBF1

There are no specific blogs for PIBF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIBF1 Antibody
NBP2-19823

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIBF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIBF1