PI 3-Kinase p110 beta/PIK3CB Antibody (4H2)

Images

 
Immunohistochemistry-Paraffin: PI 3-Kinase p110 beta/PIK3CB Antibody (4H2) [H00005291-M01] - Analysis of monoclonal antibody to PIK3CB on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
Proximity Ligation Assay: PI 3-Kinase p110 beta/PIK3CB Antibody (4H2) [H00005291-M01] - Analysis of protein-protein interactions between HCK and PIK3CB. HeLa cells were stained with anti-HCK rabbit purified polyclonal ...read more
Proximity Ligation Assay: PI 3-Kinase p110 beta/PIK3CB Antibody (4H2) [H00005291-M01] - Analysis of protein-protein interactions between HCK and PIK3CB. Huh7 cells were stained with anti-HCK rabbit purified polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, PLA
Clone
4H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PI 3-Kinase p110 beta/PIK3CB Antibody (4H2) Summary

Immunogen
PIK3CB (NP_006210 147 a.a. - 256 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Specificity
PIK3CB - phosphoinositide-3-kinase, catalytic, beta polypeptide
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIK3CB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PI 3-Kinase p110 beta/PIK3CB Antibody (4H2)

  • P110BETA
  • PI 3Kinase p110 beta
  • PI 3-Kinase p110 beta
  • PI3K
  • PI3KBETA
  • PIK3C1
  • PIK3CB phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
  • PIK3CB

Background

Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00005291-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA

Publications for PIK3CB/p110beta Antibody (H00005291-M01) (0)

There are no publications for PIK3CB/p110beta Antibody (H00005291-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3CB/p110beta Antibody (H00005291-M01) (0)

There are no reviews for PIK3CB/p110beta Antibody (H00005291-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3CB/p110beta Antibody (H00005291-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p110 beta/PIK3CB Products

Bioinformatics Tool for PIK3CB/p110beta Antibody (H00005291-M01)

Discover related pathways, diseases and genes to PIK3CB/p110beta Antibody (H00005291-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3CB/p110beta Antibody (H00005291-M01)

Discover more about diseases related to PIK3CB/p110beta Antibody (H00005291-M01).
 

Pathways for PIK3CB/p110beta Antibody (H00005291-M01)

View related products by pathway.

PTMs for PIK3CB/p110beta Antibody (H00005291-M01)

Learn more about PTMs related to PIK3CB/p110beta Antibody (H00005291-M01).
 

Research Areas for PIK3CB/p110beta Antibody (H00005291-M01)

Find related products by research area.

Blogs on PI 3-Kinase p110 beta/PIK3CB

There are no specific blogs for PI 3-Kinase p110 beta/PIK3CB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p110 beta/PIK3CB Antibody (4H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3CB
Entrez
OMIM
Uniprot