Phosphoserine phosphatase Antibody (2G9)

Images

 
Western Blot: Phosphoserine phosphatase Antibody (2G9) [H00005723-M02] - PSPH monoclonal antibody (M02), clone 2G9 Analysis of PSPH expression in K-562.
Western Blot: Phosphoserine phosphatase Antibody (2G9) [H00005723-M02] - Analysis of PSPH expression in transfected 293T cell line by PSPH monoclonal antibody (M02), clone 2G9.Lane 1: PSPH transfected lysate(25 ...read more
Sandwich ELISA: Phosphoserine phosphatase Antibody (2G9) [H00005723-M02] - Detection limit for recombinant GST tagged PSPH is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Phosphoserine phosphatase Antibody (2G9) Summary

Immunogen
PSPH (AAH63614, 1 a.a. - 225 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Specificity
PSPH - phosphoserine phosphatase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSPH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Phosphoserine phosphatase Antibody (2G9)

  • L-3-phosphoserine phosphatase
  • O-phosphoserine phosphohydrolase
  • phosphoserine phosphatase
  • PSPase
  • PSPEC 3.1.3.3

Background

The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4937
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-45897
Species: Hu
Applications: WB, IHC
9094-AG
Species: Hu
H00005723-M02
Species: Hu
Applications: WB, ELISA

Publications for Phosphoserine phosphatase Antibody (H00005723-M02) (0)

There are no publications for Phosphoserine phosphatase Antibody (H00005723-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphoserine phosphatase Antibody (H00005723-M02) (0)

There are no reviews for Phosphoserine phosphatase Antibody (H00005723-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphoserine phosphatase Antibody (H00005723-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phosphoserine phosphatase Products

Bioinformatics Tool for Phosphoserine phosphatase Antibody (H00005723-M02)

Discover related pathways, diseases and genes to Phosphoserine phosphatase Antibody (H00005723-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphoserine phosphatase Antibody (H00005723-M02)

Discover more about diseases related to Phosphoserine phosphatase Antibody (H00005723-M02).
 

Pathways for Phosphoserine phosphatase Antibody (H00005723-M02)

View related products by pathway.

PTMs for Phosphoserine phosphatase Antibody (H00005723-M02)

Learn more about PTMs related to Phosphoserine phosphatase Antibody (H00005723-M02).
 

Research Areas for Phosphoserine phosphatase Antibody (H00005723-M02)

Find related products by research area.

Blogs on Phosphoserine phosphatase

There are no specific blogs for Phosphoserine phosphatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phosphoserine phosphatase Antibody (2G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSPH
Entrez
OMIM
Uniprot