Phosphorylase B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Phosphorylase B Antibody - BSA Free (NBP2-93725) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 854-1093 of human PHKB (NP_000284.1). VIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLYQLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAGKHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PHKB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Phosphorylase B Antibody - BSA Free
Background
Phosphorylase B, also known by its gene name, PHKB, is an enzyme localized to the plasma membrane that catalyzes the phosphorylation of the amino acid residue Serine. Phosphorylase B has a 1,093 amino acid long isoform that is 125 kDa (the canonical sequence) and three other isoforms derived from alternative splicing. Current research on PHKB is being performed relating to several diseases and disorders including hepatitis and metabolic disorders, such as hypoglycemia and glycogen storage disease. Phosphorylase B has also been shown to have interactions with B Raf, hnRNP C1 + C2, PASK, and UBE3A in pathways such as Glucose and Glycogen Metabolism, PKA Signaling, cAMP Pathway, Insulin Signaling Pathway and Calcium Signaling Pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ze
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Publications for Phosphorylase B Antibody (NBP2-93725) (0)
There are no publications for Phosphorylase B Antibody (NBP2-93725).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Phosphorylase B Antibody (NBP2-93725) (0)
There are no reviews for Phosphorylase B Antibody (NBP2-93725).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Phosphorylase B Antibody (NBP2-93725) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Phosphorylase B Products
Research Areas for Phosphorylase B Antibody (NBP2-93725)
Find related products by research area.
|
Blogs on Phosphorylase B