Phosphoglucomutase 5 Antibody

Images

 
Western Blot: Phosphoglucomutase 5 Antibody [NBP1-74091] - Titration: 1.0 ug/ml Positive Control: Fetal Heart.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phosphoglucomutase 5 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of PGM5. Immunizing peptide sequence IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PGM5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Phosphoglucomutase 5 Antibody

  • aciculin
  • EC 5.4.2.2
  • PGM-RP
  • PGMRPphosphoglucomutase-like protein 5
  • phosphoglucomutase 5
  • Phosphoglucomutase-related protein

Background

Phosphoglucomutases (EC 5.2.2.2.), such as PGM5, are phosphotransferases involved in interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM activity is essential in formation of carbohydrates from glucose-6-phosphate and in formation of glucose-6-phosphate from galactose and glycogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS948
Species: Hu, Bt, Ca, Ch, Mk, Pm, Xp
Applications: IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-04508
Species: Hu
NBP1-74091
Species: Hu
Applications: WB

Publications for Phosphoglucomutase 5 Antibody (NBP1-74091) (0)

There are no publications for Phosphoglucomutase 5 Antibody (NBP1-74091).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphoglucomutase 5 Antibody (NBP1-74091) (0)

There are no reviews for Phosphoglucomutase 5 Antibody (NBP1-74091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphoglucomutase 5 Antibody (NBP1-74091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phosphoglucomutase 5 Products

Bioinformatics Tool for Phosphoglucomutase 5 Antibody (NBP1-74091)

Discover related pathways, diseases and genes to Phosphoglucomutase 5 Antibody (NBP1-74091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphoglucomutase 5 Antibody (NBP1-74091)

Discover more about diseases related to Phosphoglucomutase 5 Antibody (NBP1-74091).
 

Pathways for Phosphoglucomutase 5 Antibody (NBP1-74091)

View related products by pathway.

PTMs for Phosphoglucomutase 5 Antibody (NBP1-74091)

Learn more about PTMs related to Phosphoglucomutase 5 Antibody (NBP1-74091).

Blogs on Phosphoglucomutase 5

There are no specific blogs for Phosphoglucomutase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phosphoglucomutase 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM5