PHF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PHF2 Antibody [NBP1-83080] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF2 Protein (NBP1-83080PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF2 Antibody

  • GRC5
  • jumonji C domain-containing histone demethylase 1E
  • KIAA0662JHDM1E
  • MGC176680
  • PHD finger protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98594
Species: Hu
Applications: WB
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-93313
Species: Hu
Applications: WB, ChIP, IHC-P, IP, PLA
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP1-83080
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for PHF2 Antibody (NBP1-83080) (0)

There are no publications for PHF2 Antibody (NBP1-83080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF2 Antibody (NBP1-83080) (0)

There are no reviews for PHF2 Antibody (NBP1-83080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHF2 Antibody (NBP1-83080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF2 Products

Bioinformatics Tool for PHF2 Antibody (NBP1-83080)

Discover related pathways, diseases and genes to PHF2 Antibody (NBP1-83080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF2 Antibody (NBP1-83080)

Discover more about diseases related to PHF2 Antibody (NBP1-83080).
 

Pathways for PHF2 Antibody (NBP1-83080)

View related products by pathway.

PTMs for PHF2 Antibody (NBP1-83080)

Learn more about PTMs related to PHF2 Antibody (NBP1-83080).
 

Research Areas for PHF2 Antibody (NBP1-83080)

Find related products by research area.

Blogs on PHF2

There are no specific blogs for PHF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF2