![Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PHF2-Antibody-Immunohistochemistry-Paraffin-NBP1-83080-img0005.jpg "Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit PHF2 Antibody - BSA Free (NBP1-83080) is a polyclonal antibody validated for use in IHC. Anti-PHF2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PHF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83080 | Applications | Species |
|---|---|---|
| Lee Cheol, Kim Bohyun, Song Boram, Moon Kyung Chul Implication of PHF2 Expression in Clear Cell Renal Cell Carcinoma. Journal of Pathology and Translational Medicine 2017-06-13 [PMID: 28607325] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for PHF2 Antibody (NBP1-83080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PHF2 |
![Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human cerebellum shows strong nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/PHF2-Antibody-Immunohistochemistry-Paraffin-NBP1-83080-img0002.jpg "Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human cerebellum shows strong nuclear positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human kidney shows moderate to strong nuclear positivity in cells in glomeruli and tubules.](http://images.novusbio.com/fullsize/PHF2-Antibody-Immunohistochemistry-Paraffin-NBP1-83080-img0003.jpg "Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human kidney shows moderate to strong nuclear positivity in cells in glomeruli and tubules.")
![Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human pancreas shows strong nuclear positivity in islets of Langerhans and exocrine glandular cells.](http://images.novusbio.com/fullsize/PHF2-Antibody-Immunohistochemistry-Paraffin-NBP1-83080-img0004.jpg "Immunohistochemistry-Paraffin: PHF2 Antibody [NBP1-83080] - Staining of human pancreas shows strong nuclear positivity in islets of Langerhans and exocrine glandular cells.")
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")