PGLYRP3/PGRPIA Antibody - BSA Free

Western Blot: PGLYRP3/PGRPIA Antibody [NBP2-85468] - WB Suggested Anti-PGLYRP3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PGLYRP3/PGRPIA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PGLYRP3/PGRPIA Antibody - BSA Free (NBP2-85468) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PGLYRP3/PGRPIA. Peptide sequence: SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGLYRP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PGLYRP3/PGRPIA Antibody - BSA Free

• peptidoglycan recognition protein 3
• peptidoglycan recognition protein I alpha
• Peptidoglycan recognition protein I-alpha
• Peptidoglycan recognition protein intermediate alpha
• peptidoglycan recognition protein-I-alpha
• PGLYRP3
• PGLYRPIalphaMGC149197
• PGRP1A
• PGRPI alpha
• PGRP-I alpha
• PGRPIA
• PGRP-Ialpha
• PGRPIAPGRP-I-alpha

Background

Primary immune recognition is based on structures common among invading pathogens. Bacterial surface molecules, such as lipopolysaccharide (LPS) and peptidoglycan (PGN), are known to elicit immune reactions ranging from cytokine release to fever. Recently, a family of proteins called peptidoglycan recognition protein (PGRP) has been identified in mouse and human that binds to peptidoglycans expressed on Gram-positive bacteria. Peptidoglycan (PGN) is an essential cell wall component of virtually all bacteria (1,2) and, thus, it is an excellent target for recognition by the eukaryotic innate immune system. The PGRPs (PGRP-L, PGRP-S, PGRP-Ia , and PGRP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PGLYRP3