PFDN5 Antibody - Azide and BSA Free

Western Blot: PFDN5 Antibody [H00005204-B03P] - Analysis of PFDN5 expression in human pancreas.

Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [H00005204-B03P] - Analysis of purified antibody to PFDN5 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: PFDN5 Antibody [H00005204-B03P] - Analysis of PFDN5 expression in transfected 293T cell line. Lane 1: PFDN5 transfected lysate (16.94 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PFDN5 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PFDN5 (-, 1 a.a. - 154 a.a.) full-length human protein. MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
• Specificity: PFDN5 - prefoldin 5,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PFDN5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PFDN5 Antibody - Azide and BSA Free

• c-myc binding protein
• C-Myc-binding protein Mm-1
• MM-1
• MM1MGC71907
• Myc modulator 1
• myc modulator-1
• PFD5MGC5329
• prefoldin 5
• prefoldin subunit 5

Background

This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PFDN5
• Entrez:
  • 5204(Human)
• Uniprot:
  • BC003373(Human)