PFDN4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PFDN4 Antibody - BSA Free (NBP2-88039) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of PFDN4. Peptide sequence: ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PFDN4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PFDN4 Antibody - BSA Free
Background
PFDN4, also known as Prefoldin subunit 4, is a 134 amino acid protein that is 15 kDa, binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it, promotes folding in an environment in which there are many competing pathways for nonnative proteins, and is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Current research is being performed on this protein involvement in b-cell non-hodgkin lymphoma, non-hodgkin lymphoma, hodgkin's lymphoma, hereditary angioedema, myocardial infarction, sinusitis, gastric cancer, colorectal cancer, breast cancer, cerebritis, cholesterol, and malaria. The PFDN4 has also been shown to have interactions with MAP3K3, ACTB, PRPF4, TUBA3E, PFDN2, and plus 80 other proteins in chaperonin-mediated protein folding, prefoldin mediated transfer of substrate to CCT/TriC, cooperation of Prefoldin and TriC/CCT in actin and tubulin folding, metabolism of proteins, and protein folding pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Publications for PFDN4 Antibody (NBP2-88039) (0)
There are no publications for PFDN4 Antibody (NBP2-88039).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PFDN4 Antibody (NBP2-88039) (0)
There are no reviews for PFDN4 Antibody (NBP2-88039).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PFDN4 Antibody (NBP2-88039) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PFDN4 Products
Research Areas for PFDN4 Antibody (NBP2-88039)
Find related products by research area.
|
Blogs on PFDN4