PEX6 Antibody (3G3)

Images

 
Western Blot: PEX6 Antibody (3G3) [H00005190-M04] - Analysis of PEX6 expression in K-562 (Cat # L009V1).
ELISA: PEX6 Antibody (3G3) [H00005190-M04] - Detection limit for recombinant GST tagged PEX6 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PEX6 Antibody (3G3) Summary

Immunogen
PEX6 (NP_000278 881 a.a. - 980 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Specificity
PEX6 - peroxisomal biogenesis factor 6 (3G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PEX6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PEX6 Antibody (3G3)

  • PAF2
  • PAF-2peroxisome assembly factor 2
  • Peroxin-6
  • peroxisomal biogenesis factor 6peroxin-6
  • Peroxisomal-type ATPase 1
  • peroxisome biogenesis factor 6
  • PXAAA1peroxisomal AAA-type ATPase 1

Background

This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NBP1-57578
Species: Hu
Applications: WB
NBP2-49599
Species: Hu
Applications: WB, IHC
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32743
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005190-M04
Species: Hu
Applications: WB, ELISA

Publications for PEX6 Antibody (H00005190-M04) (0)

There are no publications for PEX6 Antibody (H00005190-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX6 Antibody (H00005190-M04) (0)

There are no reviews for PEX6 Antibody (H00005190-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX6 Antibody (H00005190-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX6 Products

Bioinformatics Tool for PEX6 Antibody (H00005190-M04)

Discover related pathways, diseases and genes to PEX6 Antibody (H00005190-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX6 Antibody (H00005190-M04)

Discover more about diseases related to PEX6 Antibody (H00005190-M04).
 

Pathways for PEX6 Antibody (H00005190-M04)

View related products by pathway.

PTMs for PEX6 Antibody (H00005190-M04)

Learn more about PTMs related to PEX6 Antibody (H00005190-M04).

Blogs on PEX6

There are no specific blogs for PEX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX6 Antibody (3G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX6
Entrez
Uniprot