PET112L Antibody - BSA Free

Western Blot: PET112L Antibody [NBP2-85460] - Host: Rabbit. Target Name: PET112. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/mlPET112 is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PET112L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PET112L Antibody - BSA Free (NBP2-85460) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PET112L. Peptide sequence: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PET112
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PET112L Antibody - BSA Free

• Cytochrome oxidase assembly factor PET112 homolog
• EC 6.3.5
• EC 6.3.5.-
• Glu-ADT subunit B
• mitochondrial
• PET112 (yeast homolog)-like
• PET112-like (yeast)

Background

Furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PET112