TMEM103 Antibody

Images

 
Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the ...read more
Biological Strategies: Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion ...read more
Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.
The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. A) ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
   

Biological Strategies

     

Order Details

TMEM103 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM103 Recombinant Protein Antigen (NBP1-91733PEP)
Publications
Read Publication using
NBP1-91733 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM103 Antibody

  • Angiotonin-transactivated protein 1
  • ATP1
  • C3orf75
  • chromosome 3 open reading frame 75
  • elongator acetyltransferase complex subunit 6
  • ELP6
  • FLJ20211
  • Protein TMEM103
  • TMEM103
  • transmembrane protein 103

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85250
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16322
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90816
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-05579
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84625
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00000514-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-83819
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP3-04984
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for TMEM103 Antibody (NBP1-91733)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM103 Antibody (NBP1-91733) (0)

There are no reviews for TMEM103 Antibody (NBP1-91733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM103 Antibody (NBP1-91733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM103 Products

Diseases for TMEM103 Antibody (NBP1-91733)

Discover more about diseases related to TMEM103 Antibody (NBP1-91733).
 

Pathways for TMEM103 Antibody (NBP1-91733)

View related products by pathway.

PTMs for TMEM103 Antibody (NBP1-91733)

Learn more about PTMs related to TMEM103 Antibody (NBP1-91733).

Blogs on TMEM103

There are no specific blogs for TMEM103, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM103 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP6