TMEM103 Antibody

Images

 
Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: C3orf75/ELP6 Antibody [NBP1-91733] - Staining of human pancreas shows distinct granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM103 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Specificity
Specificity of human C3orf75/ELP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM103 Recombinant Protein Antigen (NBP1-91733PEP)
Publications
Read Publication using
NBP1-91733 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM103 Antibody

  • Angiotonin-transactivated protein 1
  • ATP1
  • C3orf75
  • chromosome 3 open reading frame 75
  • elongator acetyltransferase complex subunit 6
  • ELP6
  • FLJ20211
  • Protein TMEM103
  • TMEM103
  • transmembrane protein 103

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85250
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008518-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43694
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NBP2-16321
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP1-84487
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45946
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
H00006187-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67199
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91733
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TMEM103 Antibody (NBP1-91733)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM103 Antibody (NBP1-91733) (0)

There are no reviews for TMEM103 Antibody (NBP1-91733). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM103 Antibody (NBP1-91733) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM103 Products

Bioinformatics Tool for TMEM103 Antibody (NBP1-91733)

Discover related pathways, diseases and genes to TMEM103 Antibody (NBP1-91733). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM103 Antibody (NBP1-91733)

Discover more about diseases related to TMEM103 Antibody (NBP1-91733).
 

Pathways for TMEM103 Antibody (NBP1-91733)

View related products by pathway.

PTMs for TMEM103 Antibody (NBP1-91733)

Learn more about PTMs related to TMEM103 Antibody (NBP1-91733).

Blogs on TMEM103

There are no specific blogs for TMEM103, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM103 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP6