PERQ2 Antibody - BSA Free

Western Blot: PERQ2 Antibody [NBP3-35210] - Western blot analysis of various lysates using PERQ2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PERQ2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human PERQ2 (NP_001096617.1).
  
  Sequence:
  VDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTDRVGVASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPAKVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GIGYF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 150 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PERQ2 Antibody - BSA Free

• DKFZp686J17223
• FLJ23368
• GRB10 interacting GYF protein 2
• GRB10-interacting GYF protein 2
• GYF domain containing 2
• GYF2
• KIAA0642DKFZp686I15154
• PARK11
• Parkinson disease (autosomal recessive, early onset) 11
• PERQ amino acid rich, with GYF domain 2
• PERQ amino acid rich, with GYF domain 3
• PERQ amino acid-rich with GYF domain-containing protein 2
• PERQ2
• PERQ3
• TNRC15
• trinucleotide repeat containing 15
• Trinucleotide repeat-containing gene 15 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GIGYF2