PERQ2 Antibody


Immunohistochemistry-Paraffin: PERQ2 Antibody [NBP2-56094] - Immunohistochemical staining of human testis shows cytoplasmic positivity.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PERQ2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Specificity of human PERQ2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PERQ2 Recombinant Protein Antigen (NBP2-56094PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PERQ2 Antibody

  • DKFZp686J17223
  • FLJ23368
  • GRB10 interacting GYF protein 2
  • GRB10-interacting GYF protein 2
  • GYF domain containing 2
  • GYF2
  • KIAA0642DKFZp686I15154
  • PARK11
  • Parkinson disease (autosomal recessive, early onset) 11
  • PERQ amino acid rich, with GYF domain 2
  • PERQ amino acid rich, with GYF domain 3
  • PERQ amino acid-rich with GYF domain-containing protein 2
  • PERQ2
  • PERQ3
  • TNRC15
  • trinucleotide repeat containing 15
  • Trinucleotide repeat-containing gene 15 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
Species: Hu, Mu, Bv, Ce, I, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PERQ2 Antibody (NBP2-56094) (0)

There are no publications for PERQ2 Antibody (NBP2-56094).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERQ2 Antibody (NBP2-56094) (0)

There are no reviews for PERQ2 Antibody (NBP2-56094). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PERQ2 Antibody (NBP2-56094) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PERQ2 Products

Array NBP2-56094

Bioinformatics Tool for PERQ2 Antibody (NBP2-56094)

Discover related pathways, diseases and genes to PERQ2 Antibody (NBP2-56094). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERQ2 Antibody (NBP2-56094)

Discover more about diseases related to PERQ2 Antibody (NBP2-56094).

Pathways for PERQ2 Antibody (NBP2-56094)

View related products by pathway.

PTMs for PERQ2 Antibody (NBP2-56094)

Learn more about PTMs related to PERQ2 Antibody (NBP2-56094).

Blogs on PERQ2

There are no specific blogs for PERQ2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PERQ2 Antibody and receive a gift card or discount.


Gene Symbol GIGYF2