Peroxiredoxin 6 Antibody - BSA Free

Western Blot: Peroxiredoxin 6 Antibody [NBP1-55159] - HepG2 cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu, Rt, Po
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Peroxiredoxin 6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the middle region of PRDX6 (NP_004896). Peptide sequence ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDX6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 24862986).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Peroxiredoxin 6 Antibody - BSA Free

• 1-Cys
• 24 kDa protein
• Acidic calcium-independent phospholipase A2
• aiPLA2
• aiPLA21-Cys PRX
• Antioxidant protein 2
• AOP2
• AOP2Non-selenium glutathione peroxidase
• EC 1.11.1.15
• EC 1.11.1.7
• EC 3.1.1.-
• KIAA0106Red blood cells page spot 12
• Liver 2D page spot 40
• MGC46173
• NSGPx
• NSGPx1-Cys peroxiredoxin
• p29
• Peroxiredoxin 6
• peroxiredoxin-6
• PRDX6
• PRX

Background

PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Peroxiredoxin 6 Antibody (NBP1-55159)(1)

Publication using NBP1-55159

• Hossain MA, De Souza AI, Bagul A et al. HSP70, Peroxiredoxin-3 and -6 are upregulated during renal warm ischaemia in a donation after circulatory death model. J Proteomics. 2014-05-24 [PMID: 24862986] (WB, Porcine)

Bioinformatics

• Gene Symbol: PRDX6
• Entrez:
  • 9588(Human)
• Uniprot:
  • P30041()